PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf10612g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family EIL
Protein Properties Length: 485aa    MW: 54195.7 Da    PI: 7.2397
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf10612g00004.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3157.51.6e-4811177129
                               XXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3   7 mwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                               mwkd+++lkrlker+k  +  ++ a++++k++++++qarrkkmsraQDgiLkYMlk me+   +GfvYgiipekgkpv+gasd++
  Peinf101Scf10612g00004.1   1 MWKDRVKLKRLKERQKIAV--QQ-AADKQKNKQTTDQARRKKMSRAQDGILKYMLKLMEA---RGFVYGIIPEKGKPVSGASDNI 79 
                               9**************9866..44.599******************************995...********************** PP

                               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.... CS
                      EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqter 129
                               raWWkekv+fd+ngpaai+ky+a++ + +++  + +++
  Peinf101Scf10612g00004.1  80 RAWWKEKVKFDKNGPAAIAKYEAECRAKGEGAPNGSRS 117
                               *********************99999888777664422 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.4E-481117No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MWKDRVKLKR LKERQKIAVQ QAADKQKNKQ TTDQARRKKM SRAQDGILKY MLKLMEARGF  60
VYGIIPEKGK PVSGASDNIR AWWKEKVKFD KNGPAAIAKY EAECRAKGEG APNGSRSEKK  120
KPSVDSDSDY DVDGVDVGNG SVSSRDERGN EPLDVRPLNA VPQSHQGKER RDGQHRRRKR  180
ARSNPQQTQL SLHDQQPDGG ARNSLPDINN SIEQFAGYIT NGSEPESNVI GSRKHVDKNS  240
EGRSELPLKE SNLSIIPSAN AVTAEDAFVG DGPSVYPIMD NSEVVPYESR FHLGSQDSIV  300
QHQLHDTQLR NRAELSGMNN EPRNSMFHYG PPNNGLHYGP QSSALHPDLQ DSSFAHGSQF  360
SSMHQPHIYQ NYASTSEFGA AHNEQQSHLA FSGSQIKPRD SGVRSSLLHE SRNDIVRENH  420
RHGKDTFQND HDRPVEMHFA SPIASGSPDY ARLSSPFNFD LDVPSTLDTG DFELFLDDDV  480
MTFFA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788578.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
RefseqXP_009788577.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
RefseqXP_016465525.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLM1BXC80.0M1BXC8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000768901e-171(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.15e-52ETHYLENE-INSENSITIVE3-like 3